PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g017080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 339aa    MW: 38367 Da    PI: 8.0943
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g017080.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.12.2e-14256307556
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                     +r+rr++kNRe+A rsR+R++a++ eLe +v +L++eN++Lk+ +ee +k+ 
  Csa06g017080.1 256 RRQRRMIKNRESAARSRARRQAYTVELELEVHNLTEENTKLKESVEENEKKR 307
                     79*****************************************999988865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-8252315IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.185254306IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-13256307No hitNo description
SuperFamilySSF579596.25E-10256305No hitNo description
PfamPF001708.3E-13256308IPR004827Basic-leucine zipper domain
PROSITE patternPS000360259274IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MSAVFETETS IFHMYPQTQM QTFVQEPVEE APVARQNSIL SLTLDEIQMK SGKSFGAMNM  60
DEFLANLWTT VEENDNSGGG GGGGGSVAHH GEKPAVLPRQ GSLSLPVPLC KKTVDEVWLE  120
IQNGVQQHHR SSTSRQNSDE DIRRQQTLGE ITLEDFLVKA GVVQEPLKTT MRMSSADFDY  180
NNPEFGVGLH CQNQNNYADN RSVYKENRPY YSVLGDSSSC MTGNGRISNN QYITGLDAFR  240
IKKRIIDGPP EVLMERRQRR MIKNRESAAR SRARRQAYTV ELELEVHNLT EENTKLKESV  300
EENEKKRRQE IINRSKHVTK EKSGDKLRKI RRMASAGW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4196000.0AJ419600.1 Arabidopsis thaliana mRNA for basic leucine zipper transcription factor (atbzip67 gene).
GenBankBT0029230.0BT002923.1 Arabidopsis thaliana clone RAFL15-01-K19 (R20103) putative bZIP protein (At3g44460) mRNA, complete cds.
GenBankBT0043420.0BT004342.1 Arabidopsis thaliana clone U20103 putative bZIP protein (At3g44460) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010514780.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
SwissprotQ8RYD60.0AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLR0H9240.0R0H924_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__854__AT3G44460.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.10.0bZIP family protein